| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Monoacylglycerol lipase ABHD6 |
|---|
| Ligand | BDBM50010337 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1352818 (CHEMBL3268614) |
|---|
| IC50 | 3.9±n/a nM |
|---|
| Citation |  Chang, JW; Hsu, KL; Tsuboi, K; Whitby, LR; Pugh, H Discovery and optimization of piperidyl-1,2,3-triazole ureas as potent, selective, and in vivo-active inhibitors of a/ß-hydrolase domain containing 6 (ABHD6). Cell Chem Biol56:8270-9 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Monoacylglycerol lipase ABHD6 |
|---|
| Name: | Monoacylglycerol lipase ABHD6 |
|---|
| Synonyms: | ABHD6_MOUSE | Abh6 | Abhd6 | Abhydrolase Domain-Containing Protein 6 | Monoacylglycerol lipase ABHD6 |
|---|
| Type: | Single-pass type II membrane protein; hydrolase |
|---|
| Mol. Mass.: | 38216.17 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | Assays were using membranes of recombinant Abh6 transiently transfected in COS-7 cells. |
|---|
| Residue: | 336 |
|---|
| Sequence: | MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYAHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYST
DNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
SFYRKLFLEIVNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEV
LENCGHSVVMERPRKTAKLIVDFLASVHNTDNKKLN
|
|
|
|---|
| BDBM50010337 |
|---|
| n/a |
|---|
| Name | BDBM50010337 |
|---|
| Synonyms: | CHEMBL3263582 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H26N4O3 |
|---|
| Mol. Mass. | 466.531 |
|---|
| SMILES | OC(=O)c1cccc(c1)-c1ccc(cc1)-c1cn(nn1)C(=O)N1CCCCC1Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
