Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA gyrase subunit B
LigandBDBM50010371
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1353018
IC50 4.0±n/a nM
Citation Ahuja VBasavarajappa HP SHBoriack-Sjodin PAMcKinney DGanguly SKranthi UGaonkar SJena LkGhorpade SRGhosh ABarde SKale MGKoushik KKumar CNManjunatha MROgg DPanduga VRamya VKReddy JKumar KNGiridhar JRudrapatna SSharma STucker JAVachaspati PWaterson Dde Sousa SM Thiazolopyridine ureas as novel antitubercular agents acting through inhibition of DNA Gyrase B. Cell Chem Biol 56:8834-48 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA gyrase subunit B
Name:DNA gyrase subunit B
Synonyms:gyrB
Type:PROTEIN
Mol. Mass.:74505.25
Organism:Mycobacterium smegmatis
Description:ChEMBL_107961
Residue:675
Sequence:
MAAQKNNAPKEYGADSITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAG
FATRVDVKIHADGSVEVRDDGRGIPVEMHATGMPTIDVVMTQLHAGGKFDGETYAVSGGL
HGVGVSVVNALSTRLEATVLRDGYEWFQYYDRSVPGKLKQGGETKETGTTIRFWADPEIF
ETTDYNFETVARRLQEMAFLNKGLTIELTDERVTAEEVVDDVVKDTAEAPKTADEKAAEA
TGPSKVKHRVFHYPGGLVDYVKHINRTKTPIQQSIIDFDGKGPGHEVEIAMQWNAGYSES
VHTFANTINTHEGGTHEEGFRAALTSVVNRYAKDKKLLKDKDPNLTGDDIREGLAAVISV
KVAEPQFEGQTKTKLGNTEVKSFVQKICNEQLQHWFEANPAEAKTVVNKAVSSAQARIAA
RKARELVRRKSATDIGGLPGKLADCRSTDPSKSELYVVEGDSAGGSAKSGRDSMFQAILP
LRGKIINVEKARIDRVLKNTEVQSIITALGTGIHDEFDISKLRYHKIVLMADADVDGQHI
STLLLTLLFRFMKPLVENGHIFLAQPPLYKLKWQRSEPEFAYSDRERDGLLEAGRAAGKK
INVDDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVEARR
SFITRNAKDVRFLDV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010371
n/a
NameBDBM50010371
Synonyms:CHEMBL3263613
TypeSmall organic molecule
Emp. Form.C25H32N6O5S
Mol. Mass.528.624
SMILESCCNC(=O)Nc1nc2cc(c(OCC3CCOC3)nc2s1)-c1cncc(OCCN2CCOCC2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: