Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 integrase
LigandBDBM50011129
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1351355
IC50 3100±n/a nM
Citation Fader LDMalenfant EParisien MCarson RBilodeau FLandry SPesant MBrochu CMorin SChabot CHalmos TBousquet YBailey MDKawai SHCoulombe RLaPlante SJakalian ABhardwaj PKWernic DSchroeder PAmad MEdwards PGarneau MDuan JCordingley MBethell RMason SWBös MBonneau PPoupart MAFaucher AMSimoneau BFenwick CYoakim CTsantrizos Y Discovery of BI 224436, a Noncatalytic Site Integrase Inhibitor (NCINI) of HIV-1. ACS Med Chem Lett 5:422-7 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 integrase
Name:Human immunodeficiency virus type 1 integrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32231.48
Organism:Human immunodeficiency virus 1
Description:ChEMBL_90865
Residue:288
Sequence:
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011129
n/a
NameBDBM50011129
Synonyms:CHEMBL3259888
TypeSmall organic molecule
Emp. Form.C18H14ClNO2
Mol. Mass.311.762
SMILESCc1nc2ccccc2c(-c2ccc(Cl)cc2)c1CC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: