Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeripheral-Type Benzodiazepine Receptor
LigandBDBM50011484
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1352881
Ki 0.235000±n/a nM
Citation Castellano STaliani SViviano MMilite CDa Pozzo ECosta BBarresi EBruno ACosconati SMarinelli LGreco GNovellino ESbardella GDa Settimo FMartini C Structure-activity relationship refinement and further assessment of 4-phenylquinazoline-2-carboxamide translocator protein ligands as antiproliferative agents in human glioblastoma tumors. J Med Chem 57:2413-28 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peripheral-Type Benzodiazepine Receptor
Name:Benzodiazepine receptors; peripheral & central
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR)
Type:Mitochondrion membrane protein
Mol. Mass.:18945.84
Organism:Rattus norvegicus (rat)
Description:Competitive binding experiments were performed on rat kidney mitochondrial membranes.
Residue:169
Sequence:
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011484
n/a
NameBDBM50011484
Synonyms:CHEMBL3261894
TypeSmall organic molecule
Emp. Form.C24H20ClN3O
Mol. Mass.401.888
SMILESCCN(Cc1ccccc1)C(=O)c1nc(-c2ccccc2Cl)c2ccccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: