| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM75566 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1352905 (CHEMBL3269422) |
|---|
| Ki | <1000±n/a nM |
|---|
| Citation |  Urbano, M; Guerrero, M; Rosen, H; Roberts, E Antagonists of the kappa opioid receptor. Bioorg Med Chem Lett24:2021-32 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM75566 |
|---|
| n/a |
|---|
| Name | BDBM75566 |
|---|
| Synonyms: | KSC-11-114-1 | KUC105392N | N-[2-[benzyl(tert-butyl)amino]ethyl]-4-[(tosylamino)methyl]benzamide | N-[2-[benzyl(tert-butyl)amino]ethyl]-4-[[(4-methylphenyl)sulfonylamino]methyl]benzamide | N-[2-[tert-butyl-(phenylmethyl)amino]ethyl]-4-[[(4-methylphenyl)sulfonylamino]methyl]benzamide | cid_45115589 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H35N3O3S |
|---|
| Mol. Mass. | 493.661 |
|---|
| SMILES | Cc1ccc(cc1)S(=O)(=O)NCc1ccc(cc1)C(=O)NCCN(Cc1ccccc1)C(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
