| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 3 |
|---|
| Ligand | BDBM50012323 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1351244 (CHEMBL3271699) |
|---|
| IC50 | 4600±n/a nM |
|---|
| Citation |  Thuaud, F; Kojima, S; Hirai, G; Oonuma, K; Tsuchiya, A; Uchida, T; Tsuchimoto, T; Sodeoka, M RE12 derivatives displaying Vaccinia H1-related phosphatase (VHR) inhibition in the presence of detergent and their anti-proliferative activity against HeLa cells. Bioorg Med Chem22:2771-82 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 3 |
|---|
| Name: | Dual specificity protein phosphatase 3 |
|---|
| Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 20480.58 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 185 |
|---|
| Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
|---|
| BDBM50012323 |
|---|
| n/a |
|---|
| Name | BDBM50012323 |
|---|
| Synonyms: | CHEMBL3260378 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H32ClNO5 |
|---|
| Mol. Mass. | 534.042 |
|---|
| SMILES | Cc1cccc(CN\C(CCCCc2ccc(OCc3ccc(Cl)cc3)cc2)=C2/C(=O)OC(CO)C2=O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
