Reaction Details |
| Report a problem with these data |
Target | Bcl-2-like protein 2 |
---|
Ligand | BDBM53290 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1349705 (CHEMBL3266889) |
---|
Ki | 8190±n/a nM |
---|
Citation | Abulwerdi, FA; Liao, C; Mady, AS; Gavin, J; Shen, C; Cierpicki, T; Stuckey, JA; Showalter, HD; Nikolovska-Coleska, Z 3-Substituted-N-(4-hydroxynaphthalen-1-yl)arylsulfonamides as a novel class of selective Mcl-1 inhibitors: structure-based design, synthesis, SAR, and biological evaluation. J Med Chem57:4111-33 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-like protein 2 |
---|
Name: | Bcl-2-like protein 2 |
Synonyms: | Apoptosis regulator Bcl-W | B2CL2_HUMAN | BCL-W | BCL2L2 | BCLW | Bcl-2-like protein 2 | Bcl2-L-2 | KIAA0271 |
Type: | Protein |
Mol. Mass.: | 20742.61 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 193 |
Sequence: | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
GALVTVGAFFASK
|
|
|
BDBM53290 |
---|
n/a |
---|
Name | BDBM53290 |
Synonyms: | 2-[4-[(4-bromophenyl)sulfonylamino]-1-hydroxynaphthalen-2-yl]sulfanylacetic acid | 2-[4-[(4-bromophenyl)sulfonylamino]-1-oxidanyl-naphthalen-2-yl]sulfanylethanoic acid | 2-[[4-(brosylamino)-1-hydroxy-2-naphthyl]thio]acetic acid | 2-[[4-[(4-bromophenyl)sulfonylamino]-1-hydroxy-2-naphthalenyl]thio]acetic acid | MLS001196198 | SMR000558497 | [(4-{[(4-bromophenyl)sulfonyl]amino}-1-hydroxy-2-naphthyl)thio]acetic acid | cid_992586 |
Type | Small organic molecule |
Emp. Form. | C18H14BrNO5S2 |
Mol. Mass. | 468.341 |
SMILES | OC(=O)CSc1cc(NS(=O)(=O)c2ccc(Br)cc2)c2ccccc2c1O |
Structure |
|