| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member B1 |
|---|
| Ligand | BDBM50015584 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1348878 (CHEMBL3271147) |
|---|
| IC50 | 90±n/a nM |
|---|
| Citation |  Ovais, S; Pushpalatha, H; Reddy, GB; Rathore, P; Bashir, R; Yaseen, S; Dheyaa, A; Yaseen, R; Tanwar, O; Akthar, M; Samim, M; Javed, K Synthesis and biological evaluation of some new pyrazoline substituted benzenesulfonylurea/thiourea derivatives as anti-hyperglycaemic agents and aldose reductase inhibitors. Eur J Med Chem80:209-17 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member B1 |
|---|
| Name: | Aldo-keto reductase family 1 member B1 |
|---|
| Synonyms: | ALDR_RAT | Akr1b1 | Akr1b4 | Aldose reductase | Aldr1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 35797.87 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_1512484 |
|---|
| Residue: | 316 |
|---|
| Sequence: | MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQ
EKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGP
DYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKP
AVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAK
YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCA
LMSCAKHKDYPFHAEV
|
|
|
|---|
| BDBM50015584 |
|---|
| n/a |
|---|
| Name | BDBM50015584 |
|---|
| Synonyms: | CHEMBL3260152 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H31N5O2S2 |
|---|
| Mol. Mass. | 569.74 |
|---|
| SMILES | CN(C)c1ccc(cc1)C1=NN(C(C1)c1ccccc1)c1ccc(cc1)S(=O)(=O)NC(=S)NCc1ccccc1 |t:10| |
|---|
| Structure | 
|
|---|
Search and Browse
