Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member B1 |
---|
Ligand | BDBM50015586 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1348878 (CHEMBL3271147) |
---|
IC50 | 85±n/a nM |
---|
Citation | Ovais, S; Pushpalatha, H; Reddy, GB; Rathore, P; Bashir, R; Yaseen, S; Dheyaa, A; Yaseen, R; Tanwar, O; Akthar, M; Samim, M; Javed, K Synthesis and biological evaluation of some new pyrazoline substituted benzenesulfonylurea/thiourea derivatives as anti-hyperglycaemic agents and aldose reductase inhibitors. Eur J Med Chem80:209-17 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member B1 |
---|
Name: | Aldo-keto reductase family 1 member B1 |
Synonyms: | ALDR_RAT | Akr1b1 | Akr1b4 | Aldose reductase | Aldr1 |
Type: | PROTEIN |
Mol. Mass.: | 35797.87 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_1512484 |
Residue: | 316 |
Sequence: | MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQ
EKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGP
DYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKP
AVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAK
YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCA
LMSCAKHKDYPFHAEV
|
|
|
BDBM50015586 |
---|
n/a |
---|
Name | BDBM50015586 |
Synonyms: | CHEMBL3260155 |
Type | Small organic molecule |
Emp. Form. | C31H30ClN5O2S2 |
Mol. Mass. | 604.185 |
SMILES | CN(C)c1ccc(cc1)C1=NN(C(C1)c1ccccc1Cl)c1ccc(cc1)S(=O)(=O)NC(=S)NCc1ccccc1 |t:10| |
Structure |
|