Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor subunit alpha-7
LigandBDBM50049750
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1348244
Ki 148±n/a nM
Citation Clark RBLamppu DLibertine LMcDonough AKumar ALaRosa GRush RElbaum D Discovery of novel 2-((pyridin-3-yloxy)methyl)piperazines asa7 nicotinic acetylcholine receptor modulators for the treatment of inflammatory disorders. J Med Chem 57:3966-83 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor subunit alpha-7
Name:Neuronal acetylcholine receptor subunit alpha-7
Synonyms:CHRNA7 | Cholinergic, Nicotinic Alpha7 | NACHRA7 | Neuronal acetylcholine receptor protein alpha-7 subunit | Neuronal acetylcholine receptor subunit alpha-7 (nAChR-alpha 7) | Nicotinic acetylcholine receptor alpha-7 (alpha7 nAChR)
Type:n/a
Mol. Mass.:56448.33
Organism:Homo sapiens (Human)
Description: CHRNA7 (NACHRA7)
Residue:502
Sequence:
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50049750
n/a
NameBDBM50049750
Synonyms:(S)-3-(azetidin-2-ylmethoxy)pyridine | 3-((S)-1-Azetidin-2-ylmethoxy)-pyridine | A-159470 | A-85380 | CHEMBL59986
TypeSmall organic molecule
Emp. Form.C9H12N2O
Mol. Mass.164.2044
SMILESC(Oc1cccnc1)[C@@H]1CCN1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: