| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50216055 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1348912 (CHEMBL3271543) |
|---|
| Ki | 1300±n/a nM |
|---|
| Citation |  Bai, S; Li, S; Xu, J; Peng, X; Sai, K; Chu, W; Tu, Z; Zeng, C; Mach, RH Synthesis and structure-activity relationship studies of conformationally flexible tetrahydroisoquinolinyl triazole carboxamide and triazole substituted benzamide analogues ass2 receptor ligands. J Med Chem57:4239-51 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor, sigma 1 | Oprs1 | SGMR1_MOUSE | Sigma 1-type opioid receptor | Sigma1-receptor | Sigma1R | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25246.51 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | O55242 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPS
TLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS
|
|
|
|---|
| BDBM50216055 |
|---|
| n/a |
|---|
| Name | BDBM50216055 |
|---|
| Synonyms: | CHEMBL387741 | N-[4-(6,7-dimethoxy-3,4-dihydro-1H-isoquinolin-2-yl)-butyl]-2-(2-fluoro-ethoxy)-5-iodo-benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H30FIN2O4 |
|---|
| Mol. Mass. | 556.4089 |
|---|
| SMILES | COc1cc2CCN(CCCCNC(=O)c3cc(I)ccc3OCCF)Cc2cc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
