Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50016796 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1357878 (CHEMBL3285765) |
---|
IC50 | 740±n/a nM |
---|
Citation | Chaykovsky, M; Hirst, M; Lazarus, H; Martinelli, JE Methotrexate analogues. 9. Synthesis and biological properties of some 8-alkyl-7,8-dihydro analogues. J Med Chem20:1323-7 (1977) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_LACCA | dhfR | folA |
Type: | PROTEIN |
Mol. Mass.: | 18437.08 |
Organism: | Lactobacillus casei |
Description: | ChEMBL_1357878 |
Residue: | 163 |
Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
BDBM50016796 |
---|
n/a |
---|
Name | BDBM50016796 |
Synonyms: | CHEMBL3273852 |
Type | Small organic molecule |
Emp. Form. | C27H30N8O5 |
Mol. Mass. | 546.5777 |
SMILES | CN(CC1=Nc2c(N)nc(N)nc2N(Cc2ccccc2)C1)c1ccc(cc1)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r,t:3| |
Structure |
|