Reaction Details |
| Report a problem with these data |
Target | P2Y purinoceptor 2 |
---|
Ligand | BDBM50015276 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1365178 (CHEMBL3292928) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Jeon, YT; Yang, W; Qiao, JX; Li, L; Ruel, R; Thibeault, C; Hiebert, S; Wang, TC; Wang, Y; Liu, Y; Clark, CG; Wong, HS; Zhu, J; Wu, DR; Sun, D; Chen, BC; Mathur, A; Chacko, SA; Malley, M; Chen, XQ; Shen, H; Huang, CS; Schumacher, WA; Bostwick, JS; Stewart, AB; Price, LA; Hua, J; Li, D; Levesque, PC; Seiffert, DA; Rehfuss, R; Wexler, RR; Lam, PY Identification of 1-{2-[4-chloro-1'-(2,2-dimethylpropyl)-7-hydroxy-1,2-dihydrospiro[indole-3,4'-piperidine]-1-yl]phenyl}-3-{5-chloro-[1,3]thiazolo[5,4-b]pyridin-2-yl}urea, a potent, efficacious and orally bioavailable P2Y(1) antagonist as an antiplatelet agent. Bioorg Med Chem Lett24:1294-8 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
P2Y purinoceptor 2 |
---|
Name: | P2Y purinoceptor 2 |
Synonyms: | ATP receptor | P2RU1 | P2RY2 | P2RY2_HUMAN | P2U purinoceptor 1 | P2U1 | P2Y purinoceptor 2 | P2Y2 | Purinergic receptor | Purinergic receptor P2Y2 |
Type: | PROTEIN |
Mol. Mass.: | 42299.21 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1455361 |
Residue: | 377 |
Sequence: | MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC
RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR
VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK
RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR
RTESTPAGSENTKDIRL
|
|
|
BDBM50015276 |
---|
n/a |
---|
Name | BDBM50015276 |
Synonyms: | CHEMBL3263056 | US9428504, 166 | US9428504, 167 |
Type | Small organic molecule |
Emp. Form. | C30H32Cl2N6O2S |
Mol. Mass. | 611.585 |
SMILES | CC(C)(C)CN1CCC2(CN(c3c2c(Cl)ccc3O)c2ccccc2NC(=O)Nc2nc3ccc(Cl)nc3s2)CC1 |
Structure |
|