Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y2
LigandBDBM50015276
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1365178
IC50>10000±n/a nM
Citation Jeon YTYang WQiao JXLi LRuel RThibeault CHiebert SWang TCWang YLiu YClark CGWong HSZhu JWu DRSun DChen BCMathur AChacko SAMalley MChen XQShen HHuang CSSchumacher WABostwick JSStewart ABPrice LAHua JLi DLevesque PCSeiffert DARehfuss RWexler RRLam PY Identification of 1-{2-[4-chloro-1'-(2,2-dimethylpropyl)-7-hydroxy-1,2-dihydrospiro[indole-3,4'-piperidine]-1-yl]phenyl}-3-{5-chloro-[1,3]thiazolo[5,4-b]pyridin-2-yl}urea, a potent, efficacious and orally bioavailable P2Y(1) antagonist as an antiplatelet agent. Bioorg Med Chem Lett 24:1294-8 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y2
Name:Purinergic receptor P2Y2
Synonyms:ATP receptor | P2U purinoceptor 1 | P2U1 | P2Y purinoceptor 2 | P2Y2 | Purinergic receptor
Type:PROTEIN
Mol. Mass.:42299.21
Organism:Homo sapiens (Human)
Description:ChEMBL_1455361
Residue:377
Sequence:
MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC
RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR
VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK
RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR
RTESTPAGSENTKDIRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50015276
n/a
NameBDBM50015276
Synonyms:CHEMBL3263056 | US9428504, 166 | US9428504, 167
TypeSmall organic molecule
Emp. Form.C30H32Cl2N6O2S
Mol. Mass.611.585
SMILESCC(C)(C)CN1CCC2(CN(c3c2c(Cl)ccc3O)c2ccccc2NC(=O)Nc2nc3ccc(Cl)nc3s2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: