| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocyte-stimulating hormone receptor |
|---|
| Ligand | BDBM50017132 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1365585 (CHEMBL3297366) |
|---|
| EC50 | 40±n/a nM |
|---|
| Citation |  Haslach, EM; Huang, H; Dirain, M; Debevec, G; Geer, P; Santos, RG; Giulianotti, MA; Pinilla, C; Appel, JR; Doering, SR; Walters, MA; Houghten, RA; Haskell-Luevano, C Identification of tetrapeptides from a mixture based positional scanning library that can restore nM full agonist function of the L106P, I69T, I102S, A219V, C271Y, and C271R human melanocortin-4 polymorphic receptors (hMC4Rs). J Med Chem57:4615-28 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocyte-stimulating hormone receptor |
|---|
| Name: | Melanocyte-stimulating hormone receptor |
|---|
| Synonyms: | MC1-R | MSHR_MOUSE | Mc1r | Melanocortin receptor 1 | Melanocyte-stimulating hormone receptor | Msh-r |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 35238.60 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_1498846 |
|---|
| Residue: | 315 |
|---|
| Sequence: | MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIA
ITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDV
LICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITY
YKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAAT
LTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRS
QELRMTLKEVLLCSW
|
|
|
|---|
| BDBM50017132 |
|---|
| n/a |
|---|
| Name | BDBM50017132 |
|---|
| Synonyms: | CHEMBL3287325 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H45I2N11O5 |
|---|
| Mol. Mass. | 917.5793 |
|---|
| SMILES | CC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](Cc1ccc(I)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1ccc(I)cc1)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
