Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 3
LigandBDBM50017131
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1365586
EC50 47±n/a nM
Citation Haslach EMHuang HDirain MDebevec GGeer PSantos RGGiulianotti MAPinilla CAppel JRDoering SRWalters MAHoughten RAHaskell-Luevano C Identification of tetrapeptides from a mixture based positional scanning library that can restore nM full agonist function of the L106P, I69T, I102S, A219V, C271Y, and C271R human melanocortin-4 polymorphic receptors (hMC4Rs). J Med Chem 57:4615-28 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 3
Name:Melanocortin receptor 3
Synonyms:MC3-R
Type:PROTEIN
Mol. Mass.:35808.24
Organism:Mus musculus
Description:ChEMBL_1498848
Residue:323
Sequence:
MNSSCCLSSVSPMLPNLSEHPAAPPASNRSGSGFCEQVFIKPEVFLALGIVSLMENILVI
LAVVRNGNLHSPMYFFLCSLAAADMLVSLSNSLETIMIAVINSDSLTLEDQFIQHMDNIF
DSMICISLVASICNLLAIAIDRYVTIFYALRYHSIMTVRKALTLIGVIWVCCGICGVMFI
IYSESKMVIVCLITMFFAMVLLMGTLYIHMFLFARLHVQRIAVLPPAGVVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFKEILCGCNSMNLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50017131
n/a
NameBDBM50017131
Synonyms:CHEMBL3287324
TypeSmall organic molecule
Emp. Form.C36H42IN9O7
Mol. Mass.839.6793
SMILESCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](Cc1ccc(I)cc1)C(=O)N1Cc2ccccc2CC1C(=O)N[C@H](Cc1ccc(cc1)[N+]([O-])=O)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: