Reaction Details |
| Report a problem with these data |
Target | Melanocortin receptor 5 |
---|
Ligand | BDBM50017132 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1365588 (CHEMBL3297369) |
---|
EC50 | 3.0±n/a nM |
---|
Citation | Haslach, EM; Huang, H; Dirain, M; Debevec, G; Geer, P; Santos, RG; Giulianotti, MA; Pinilla, C; Appel, JR; Doering, SR; Walters, MA; Houghten, RA; Haskell-Luevano, C Identification of tetrapeptides from a mixture based positional scanning library that can restore nM full agonist function of the L106P, I69T, I102S, A219V, C271Y, and C271R human melanocortin-4 polymorphic receptors (hMC4Rs). J Med Chem57:4615-28 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melanocortin receptor 5 |
---|
Name: | Melanocortin receptor 5 |
Synonyms: | MC5R_MOUSE | Mc5r | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
Type: | Enzyme |
Mol. Mass.: | 36966.58 |
Organism: | Mus musculus (Mouse) |
Description: | P41149 |
Residue: | 325 |
Sequence: | MNSSSTLTVLNLTLNASEDGILGSNVKNKSLACEEMGIAVEVFLTLGLVSLLENILVIGA
IVKNKNLHSPMYFFVGSLAVADMLVSMSNAWETVTIYLLNNKHLVIADTFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYITIFYALRYHHIMTARRSGVIIACIWTFCISCGIVFIIY
YESKYVIICLISMFFTMLFFMVSLYIHMFLLARNHVKRIAASPRYNSVRQRTSMKGAITL
TMLLGIFIVCWSPFFLHLILMISCPQNVYCSCFMSYFNMYLILIMCNSVIDPLIYALRSQ
EMRRTFKEIVCCHGFRRPCRLLGGY
|
|
|
BDBM50017132 |
---|
n/a |
---|
Name | BDBM50017132 |
Synonyms: | CHEMBL3287325 |
Type | Small organic molecule |
Emp. Form. | C32H45I2N11O5 |
Mol. Mass. | 917.5793 |
SMILES | CC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](Cc1ccc(I)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1ccc(I)cc1)C(N)=O |r| |
Structure |
|