Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 5 (MC5R)
LigandBDBM50017181
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1365588
EC50 0.260000±n/a nM
Citation Haslach EMHuang HDirain MDebevec GGeer PSantos RGGiulianotti MAPinilla CAppel JRDoering SRWalters MAHoughten RAHaskell-Luevano C Identification of tetrapeptides from a mixture based positional scanning library that can restore nM full agonist function of the L106P, I69T, I102S, A219V, C271Y, and C271R human melanocortin-4 polymorphic receptors (hMC4Rs). J Med Chem 57:4615-28 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 5 (MC5R)
Name:Melanocortin receptor 5
Synonyms:Melanocortin receptor 5
Type:Enzyme
Mol. Mass.:36966.58
Organism:Mus musculus (Mouse)
Description:P41149
Residue:325
Sequence:
MNSSSTLTVLNLTLNASEDGILGSNVKNKSLACEEMGIAVEVFLTLGLVSLLENILVIGA
IVKNKNLHSPMYFFVGSLAVADMLVSMSNAWETVTIYLLNNKHLVIADTFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYITIFYALRYHHIMTARRSGVIIACIWTFCISCGIVFIIY
YESKYVIICLISMFFTMLFFMVSLYIHMFLLARNHVKRIAASPRYNSVRQRTSMKGAITL
TMLLGIFIVCWSPFFLHLILMISCPQNVYCSCFMSYFNMYLILIMCNSVIDPLIYALRSQ
EMRRTFKEIVCCHGFRRPCRLLGGY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50017181
n/a
NameBDBM50017181
Synonyms:CHEMBL441738
TypeSmall organic molecule
Emp. Form.C78H111N21O19
Mol. Mass.1646.8452
SMILESCCCC[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(C)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: