Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4B
LigandBDBM50017326
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1362418
IC50 0.100000±n/a nM
Citation De Savi CCox RJWarner DJCook ARDickinson MRMcDonough AMorrill LCParker BAndrews GYoung SSGilmour PSRiley RDearman MS Efficacious inhaled PDE4 inhibitors with low emetic potential and long duration of action for the treatment of COPD. J Med Chem 57:4661-76 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4B
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4B
Synonyms:DPDE4 | Isoform PDE4B1 | PDE32 | PDE4B1 | Phosphodiesterase 4B | Phosphodiesterase 4B (PDE4B) | Phosphodiesterase 4B (PDE4B1) | Phosphodiesterase Type 4 (PDE4B)
Type:Protein
Mol. Mass.:83318.87
Organism:Homo sapiens (Human)
Description:Q07343-1
Residue:736
Sequence:
MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVL
HATFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVR
NNFTILTNLHGTSNKRSPAASQPPVSRVNPQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLG
ETDIDIATEDKSPVDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50017326
n/a
NameBDBM50017326
Synonyms:CHEMBL3288015
TypeSmall organic molecule
Emp. Form.C35H38FN5O4S
Mol. Mass.643.771
SMILESCc1nc(cs1)C(=O)N[C@H]1CC[C@H](CC1)NC(=O)c1cc(F)cnc1Oc1cccc(c1)-c1ccc(CN2CCCOCC2)cc1 |r,wU:9.9,12.16,(49.63,.92,;48.09,.87,;47.23,-.41,;45.75,.04,;45.7,1.57,;47.15,2.09,;44.53,-.91,;44.53,-2.46,;43.2,-.14,;41.85,-.91,;41.85,-2.46,;40.52,-3.22,;39.18,-2.45,;39.18,-.92,;40.52,-.14,;37.85,-3.22,;36.51,-2.46,;36.51,-.92,;35.18,-3.23,;33.84,-2.47,;32.51,-3.24,;31.17,-2.47,;32.5,-4.79,;33.85,-5.56,;35.19,-4.79,;36.52,-5.56,;36.52,-7.1,;35.19,-7.87,;35.19,-9.41,;36.53,-10.18,;37.86,-9.4,;37.86,-7.86,;39.2,-10.16,;39.2,-11.7,;40.54,-12.46,;41.87,-11.69,;43.21,-12.45,;43.22,-13.99,;44.59,-14.64,;44.95,-16.14,;44.01,-17.35,;42.47,-17.35,;41.5,-16.16,;41.83,-14.66,;41.86,-10.14,;40.52,-9.38,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: