Reaction Details |
| Report a problem with these data |
Target | Fibroblast growth factor 1 |
---|
Ligand | BDBM50017347 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1363179 (CHEMBL3293894) |
---|
Kd | 8000±n/a nM |
---|
Citation | Roy, S; El Hadri, A; Richard, S; Denis, F; Holte, K; Duffner, J; Yu, F; Galcheva-Gargova, Z; Capila, I; Schultes, B; Petitou, M; Kaundinya, GV Synthesis and biological evaluation of a unique heparin mimetic hexasaccharide for structure-activity relationship studies. J Med Chem57:4511-20 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fibroblast growth factor 1 |
---|
Name: | Fibroblast growth factor 1 |
Synonyms: | Acidic fibroblast growth factor | Beta-endothelial cell growth factor | ECGF-beta | FGF1 | FGF1_HUMAN | FGFA | Fibroblast growth factor 1 (FGF-1) | HBGF-1 | Heparin-binding growth factor 1 | aFGF |
Type: | Protein |
Mol. Mass.: | 17461.01 |
Organism: | Homo sapiens (Human) |
Description: | P05230 |
Residue: | 155 |
Sequence: | MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
|
|
|
BDBM50017347 |
---|
n/a |
---|
Name | BDBM50017347 |
Synonyms: | CHEMBL3288259 |
Type | Small organic molecule |
Emp. Form. | C41H61N4Na9O49S6 |
Mol. Mass. | 1793.218 |
SMILES | [Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[H][C@]1(O[C@@H]2O[C@H]([C@@H](O)[C@H](O)[C@H]2OS([O-])(=O)=O)C([O-])=O)[C@H](O)[C@@H](NS([O-])(=O)=O)[C@@H](O[C@@]2([H])[C@H](O)[C@@H](OS([O-])(=O)=O)[C@H](O[C@@]3([H])[C@H](O)[C@@H](NS([O-])(=O)=O)[C@@H](O[C@@]4([H])[C@H](O)[C@@H](OS([O-])(=O)=O)[C@H](O[C@@]5([H])[C@H](O)[C@@H](NS([O-])(=O)=O)[C@@H](OCCCCCN)O[C@@H]5CO)O[C@H]4C([O-])=O)O[C@@H]3CO)O[C@H]2C([O-])=O)O[C@@H]1CO |r| |
Structure |
|