Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C motif chemokine 2
LigandBDBM50017345
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1363185
Kd 250000000±n/a nM
Citation Roy SEl Hadri ARichard SDenis FHolte KDuffner JYu FGalcheva-Gargova ZCapila ISchultes BPetitou MKaundinya GV Synthesis and biological evaluation of a unique heparin mimetic hexasaccharide for structure-activity relationship studies. J Med Chem 57:4511-20 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C motif chemokine 2
Name:C-X-C motif chemokine 2
Synonyms:CXCL2 | GRO-beta(5-73) | GRO-beta-T | GRO2 | GROB | Gro-beta | Growth-regulated protein beta | HSF | Hematopoietic synergistic factor | MIP2-alpha | MIP2A | Macrophage inflammatory protein 2-alpha | SB-251353 | SCYB2
Type:PROTEIN
Mol. Mass.:11402.68
Organism:Homo sapiens (Human)
Description:ChEMBL_108378
Residue:107
Sequence:
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50017345
n/a
NameBDBM50017345
Synonyms:CHEMBL3288260
TypeSmall organic molecule
Emp. Form.C45H64N3Na9O51S6
Mol. Mass.1862.277
SMILES[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[H][C@]1(O[C@@H]2O[C@@H](C([O-])=O)[C@@]([H])(O[C@H]3O[C@H](COS([O-])(=O)=O)[C@@]([H])(O[C@@H]4O[C@@H](C([O-])=O)[C@@]([H])(O[C@H]5O[C@H](COS([O-])(=O)=O)[C@@]([H])(O[C@@H]6O[C@H]([C@@H](O)[C@H](O)[C@H]6OS([O-])(=O)=O)C([O-])=O)[C@H](O)[C@H]5NC(C)=O)[C@H](O)[C@H]4OS([O-])(=O)=O)[C@H](O)[C@H]3NS([O-])(=O)=O)[C@H](O)[C@H]2O)[C@H](O)[C@@H](NC(C)=O)[C@@H](OCCCCC)O[C@@H]1COS([O-])(=O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: