Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target11-beta-hydroxysteroid dehydrogenase 1
LigandBDBM50018812
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1362859
IC50 634±n/a nM
Citation Gillespie PPietranico-Cole SMyers MBilotta JAConde-Knape KFotouhi NGoodnow RAGuertin KRHamilton MMHaynes NELiu BQi LRen YScott NRSo SSSpence CTaub RThakkar KTilley JWZwingelstein C Discovery of camphor-derived pyrazolones as 11-hydroxysteroid dehydrogenase type 1 inhibitors. Bioorg Med Chem Lett 24:2707-11 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
11-beta-hydroxysteroid dehydrogenase 1
Name:11-beta-hydroxysteroid dehydrogenase 1
Synonyms:11-DH | 11-beta-HSD1 | 11-beta-Hydroxysteroid Dehydrogenase 1 (11-beta-HSD1) | 11-beta-hydroxysteroid dehydrogenase 1 (11HSD1) | Corticosteroid 11-beta-dehydrogenase isozyme 1 | Corticosteroid 11-beta-dehydrogenase isozyme 1 (11-beta-HSD-1) | Corticosteroid 11-beta-dehydrogenase isozyme 1 (11-beta-HSD1) | Corticosteroid 11-beta-dehydrogenase isozyme 1 (11beta-HSD1)
Type:Enzyme
Mol. Mass.:32409.16
Organism:Homo sapiens (Human)
Description:P28845
Residue:292
Sequence:
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAH
VVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNH
ITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMV
AAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEE
CALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50018812
n/a
NameBDBM50018812
Synonyms:CHEMBL3291353
TypeSmall organic molecule
Emp. Form.C17H21N3O
Mol. Mass.283.3681
SMILES[H][C@@]12CC[C@@](C)(c3c1c(=O)n(-c1ccccn1)n3C)C2(C)C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: