| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Catechol O-methyltransferase |
|---|
| Ligand | BDBM50019331 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1362908 (CHEMBL3291950) |
|---|
| Ki | 63000±n/a nM |
|---|
| Citation |  Lanier, M; Ambrus, G; Cole, DC; Davenport, R; Ellery, J; Fosbeary, R; Jennings, AJ; Kadotani, A; Kamada, Y; Kamran, R; Matsumoto, S; Mizukami, A; Okubo, S; Okada, K; Saikatendu, K; Walsh, L; Wu, H; Hixon, MS A fragment-based approach to identifying S-adenosyl-l-methionine -competitive inhibitors of catechol O-methyl transferase (COMT). J Med Chem57:5459-63 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Catechol O-methyltransferase |
|---|
| Name: | Catechol O-methyltransferase |
|---|
| Synonyms: | COMT_MOUSE | Comt | Comt1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 29482.97 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_108370 |
|---|
| Residue: | 265 |
|---|
| Sequence: | MLLAAVSLGLLLLAFLLLLRHLGWGLVAIGWFEFVQQPVHNLLMGGTKEQRILRHVQQHA
KPGDPQSVLEAIDTYCSEKEWAMNVGDAKGQIMDAVIREYRPSLVLELGAYCGYSAVRMA
RLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGASQDLIPQLKKKYDVDTLDM
VFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSY
LEYMKVVDGLEKAVYQGPGSSPVKS
|
|
|
|---|
| BDBM50019331 |
|---|
| n/a |
|---|
| Name | BDBM50019331 |
|---|
| Synonyms: | CHEMBL3289430 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H10N4 |
|---|
| Mol. Mass. | 162.1918 |
|---|
| SMILES | Cc1nn(C)cc1-c1cc[nH]n1 |
|---|
| Structure | 
|
|---|
Search and Browse
