Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 11B2 (CYP11B2)
LigandBDBM8611
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1361874
IC50 0.800000±n/a nM
Citation Yin LHu QEmmerich JLo MMMetzger EAli AHartmann RW Novel pyridyl- or isoquinolinyl-substituted indolines and indoles as potent and selective aldosterone synthase inhibitors. J Med Chem 57:5179-89 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 11B2 (CYP11B2)
Name:Cytochrome P450 11B2
Synonyms:Aldosterone Synthase (CYP11B2) | Aldosterone synthase | Aldosterone-synthesizing enzyme | CYPXIB2 | Cytochrome P450 11B2 | Cytochrome P450 11B2, mitochondrial | P-450Aldo | P-450C18 | Steroid 18-hydroxylase
Type:Protein
Mol. Mass.:57582.15
Organism:Homo sapiens (Human)
Description:P19099
Residue:503
Sequence:
MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQG
YEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELS
LEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRP
ERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQED
IKMVYSFILRPGTSPLLTFRAIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8611
n/a
NameBDBM8611
Synonyms:4-{5H,6H,7H,8H-imidazo[1,5-a]pyridin-5-yl}benzonitrile | CHEMBL468419 | CHEMBL9298 | Fadrozole | US9271963, Fadrozole
TypeSmall organic molecule
Emp. Form.C14H13N3
Mol. Mass.223.2731
SMILESN#Cc1ccc(cc1)C1CCCc2cncn12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: