Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntermediate conductance calcium-activated potassium channel protein 4
LigandBDBM50019907
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1361891
IC50 60±n/a nM
Citation Blass B Fused Thiazin-3-ones as KCa3.1 Inhibitors. ACS Med Chem Lett 5:460-1 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Intermediate conductance calcium-activated potassium channel protein 4
Name:Intermediate conductance calcium-activated potassium channel protein 4
Synonyms:IK1 | IKCa1 | KCa4 | Putative Gardos channel | SK4
Type:PROTEIN
Mol. Mass.:47723.22
Organism:Homo sapiens (Human)
Description:ChEMBL_1361891
Residue:427
Sequence:
MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFL
VKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPA
PVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
LREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP
EPSQQSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50019907
n/a
NameBDBM50019907
Synonyms:CHEMBL3287212
TypeSmall organic molecule
Emp. Form.C14H10F4N2O2S2
Mol. Mass.378.365
SMILESCC(N1c2scnc2SCC1=O)c1ccc(F)c(OC(F)(F)F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: