Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGPR103
LigandBDBM50019974
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1363387
IC50 2512±n/a nM
Citation Nordqvist AKristensson LJohansson KEIsaksson da Silva KFex TTyrchan CSvensson Henriksson ANilsson K New Hits as Antagonists of GPR103 Identified by HTS. ACS Med Chem Lett 5:527-32 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GPR103
Name:GPR103
Synonyms:Pyroglutamylated RFamide peptide receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:49508.46
Organism:Homo sapiens (Human)
Description:GPR103 0 HUMAN::Q96P65
Residue:431
Sequence:
MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLALVLTGVLIFALAL
FGNALVFYVVTRSKAMRTVTNIFICSLALSDLLITFFCIPVTMLQNISDNWLGGAFICKM
VPFVQSTAVVTEILTMTCIAVERHQGLVHPFKMKWQYTNRRAFTMLGVVWLVAVIVGSPM
WHVQQLEIKYDFLYEKEHICCLEEWTSPVHQKIYTTFILVILFLLPLMVMLILYSKIGYE
LWIKKRVGDGSVLRTIHGKEMSKIARKKKRAVIMMVTVVALFAVCWAPFHVVHMMIEYSN
FEKEYDDVTIKMIFAIVQIIGFSNSICNPIVYAFMNENFKKNVLSAVCYCIVNKTFSPAQ
RHGNSGITMMRKKAKFSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSE
LAENSPLDSGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50019974
n/a
NameBDBM50019974
Synonyms:CHEMBL3287825
TypeSmall organic molecule
Emp. Form.C17H20N2S2
Mol. Mass.316.484
SMILESN=C(Nc1cccc(CSC2CCCC2)c1)c1cccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: