| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Accessory gene regulator protein A |
|---|
| Ligand | BDBM50312649 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1366621 (CHEMBL3296715) |
|---|
| IC50 | 37800±n/a nM |
|---|
| Citation |  Figueroa, M; Jarmusch, AK; Raja, HA; El-Elimat, T; Kavanaugh, JS; Horswill, AR; Cooks, RG; Cech, NB; Oberlies, NH Polyhydroxyanthraquinones as quorum sensing inhibitors from the guttates of Penicillium restrictum and their analysis by desorption electrospray ionization mass spectrometry. J Nat Prod77:1351-8 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Accessory gene regulator protein A |
|---|
| Name: | Accessory gene regulator protein A |
|---|
| Synonyms: | AGRA_STAAU | agr | agrA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27903.57 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | ChEMBL_1366621 |
|---|
| Residue: | 238 |
|---|
| Sequence: | MKIFICEDDPKQRENMVTIIKNYIMIEEKPMEIALATDNPYEVLEQAKNMNDIGCYFLDI
QLSTDINGIKLGSEIRKHDPVGNIIFVTSHSELTYLTFVYKVAAMDFIFKDDPAELRTRI
IDCLETAHTRLQLLSKDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQI
EFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
|
|
|
|---|
| BDBM50312649 |
|---|
| n/a |
|---|
| Name | BDBM50312649 |
|---|
| Synonyms: | 6-chloro-4,5,7-trihydroxy-9,10-dioxo-9,10-dihydroanthracene-2-carboxylic acid | CHEMBL1089732 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H7ClO7 |
|---|
| Mol. Mass. | 334.665 |
|---|
| SMILES | OC(=O)c1cc(O)c2C(=O)c3c(O)c(Cl)c(O)cc3C(=O)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
