Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Blk
LigandBDBM50020476
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1361206
IC50 4.2±n/a nM
Citation Li XZuo YTang GWang YZhou YWang XGuo TXia MDing NPan Z Discovery of a series of 2,5-diaminopyrimidine covalent irreversible inhibitors of Bruton's tyrosine kinase with in vivo antitumor activity. J Med Chem 57:5112-28 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase Blk
Name:SRC
Synonyms:B lymphoid tyrosine kinase | BLK | Tyrosine-protein kinase BLK (BLK) | p55-Blk
Type:Protein
Mol. Mass.:57711.88
Organism:Homo sapiens (Human)
Description:n/a
Residue:505
Sequence:
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDK
HFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLE
MERWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIR
CLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQS
LRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKALQHERLVRLY
AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAYIERMNSIHRD
LRAANILVSEALCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWS
FGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPELYRGVIAECWRSRPEER
PTFEFLQSVLEDFYTATERQYELQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50020476
n/a
NameBDBM50020476
Synonyms:CHEMBL3290148
TypeSmall organic molecule
Emp. Form.C31H26F3N7O4
Mol. Mass.617.5778
SMILESCc1ccc(NC(=O)c2cccc(c2)C(F)(F)F)cc1C(=O)Nc1cnc(Nc2cccc(NC(=O)CNC(=O)C=C)c2)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: