Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytoplasmic tyrosine-protein kinase BMX
LigandBDBM50020471
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1366997
IC50 1.9±n/a nM
Citation Li XZuo YTang GWang YZhou YWang XGuo TXia MDing NPan Z Discovery of a series of 2,5-diaminopyrimidine covalent irreversible inhibitors of Bruton's tyrosine kinase with in vivo antitumor activity. J Med Chem 57:5112-28 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytoplasmic tyrosine-protein kinase BMX
Name:Cytoplasmic tyrosine-protein kinase BMX
Synonyms:BMX | BMX non-receptor tyrosine kinase | Bone marrow tyrosine kinase gene in chromosome X protein | Cytoplasmic tyrosine-protein kinase BMX (BMX) | ETK | Epithelial and endothelial tyrosine kinase | NTK38 | Tyrosine Kinase BMX | Tyrosine-protein kinase BMX/ETK
Type:Tyrosine-protein kinase
Mol. Mass.:78030.42
Organism:Homo sapiens (Human)
Description:P51813
Residue:675
Sequence:
MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKI
RCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKY
HSGFFVDGKFLCCQQSCKAAPGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVL
KMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDF
PDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFPESSSSEEEENLDDYDWFAGN
ISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLY
LAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPDSVSLGNGIWELKREEITLL
KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCS
KEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAAR
NCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGI
LMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQ
QLLSSIEPLREKDKH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50020471
n/a
NameBDBM50020471
Synonyms:CHEMBL3290142
TypeSmall organic molecule
Emp. Form.C29H23F3N6O3
Mol. Mass.560.5265
SMILESCc1ccc(NC(=O)c2cccc(c2)C(F)(F)F)cc1C(=O)Nc1cnc(Nc2cccc(NC(=O)C=C)c2)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: