Reaction Details |
| Report a problem with these data |
Target | Matrix protein 2 |
---|
Ligand | BDBM50020844 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1364624 (CHEMBL3291757) |
---|
IC50 | 4930±n/a nM |
---|
Citation | Rey-Carrizo, M; Barniol-Xicota, M; Ma, C; Frigolé-Vivas, M; Torres, E; Naesens, L; Llabrés, S; Juárez-Jiménez, J; Luque, FJ; DeGrado, WF; Lamb, RA; Pinto, LH; Vázquez, S Easily accessible polycyclic amines that inhibit the wild-type and amantadine-resistant mutants of the M2 channel of influenza A virus. J Med Chem57:5738-47 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Matrix protein 2 |
---|
Name: | Matrix protein 2 |
Synonyms: | M | M2_I72A8 | Proton channel protein M2 |
Type: | PROTEIN |
Mol. Mass.: | 11180.06 |
Organism: | Influenza A virus (A/Udorn/307/1972(H3N2)) |
Description: | ChEMBL_22 |
Residue: | 97 |
Sequence: | MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK
RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE
|
|
|
BDBM50020844 |
---|
n/a |
---|
Name | BDBM50020844 |
Synonyms: | CHEMBL3286403 |
Type | Small organic molecule |
Emp. Form. | C13H18ClN3 |
Mol. Mass. | 251.755 |
SMILES | Cl.NC(=N)N1CC2C(C1)C1C=CC2C2C=CC12 |c:10,15,TLB:5:6:10.11:13.16,THB:8:7:10.11:13.16,15:16:10.11:7.6,14:13:10.11:7.6| |
Structure |
|