| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50408728 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1365856 (CHEMBL3296477) |
|---|
| Ki | 1.6±n/a nM |
|---|
| Citation |  Denora, N; Margiotta, N; Laquintana, V; Lopedota, A; Cutrignelli, A; Losacco, M; Franco, M; Natile, G Synthesis, Characterization, and in Vitro Evaluation of a New TSPO-Selective Bifunctional Chelate Ligand. ACS Med Chem Lett5:685-9 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50408728 |
|---|
| n/a |
|---|
| Name | BDBM50408728 |
|---|
| Synonyms: | CHEMBL339816 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25ClN4O |
|---|
| Mol. Mass. | 384.902 |
|---|
| SMILES | CCCN(CCC)C(=O)Cc1c(nc2c(N)cccn12)-c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
