Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty-acid amide hydrolase 1
LigandBDBM50021331
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1366315
IC50 32±n/a nM
Citation Chobanian HRGuo YLiu PChioda MDFung SLanza TJChang LBakshi RKDellureficio JPHong QMcLaughlin MBelyk KMKrska SWMakarewicz AKMartel EJLeone JFFrey LKaranam BMadeira MAlvaro RShuman JSalituro GTerebetski JLJochnowitz NMistry SMcGowan EHajdu RRosenbach MAbbadie CAlexander JPShiao LLSullivan KMNargund RPWyvratt MJLin LSDeVita RJ Discovery of MK-4409, a Novel Oxazole FAAH Inhibitor for the Treatment of Inflammatory and Neuropathic Pain. ACS Med Chem Lett 5:717-21 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fatty-acid amide hydrolase 1
Name:Fatty-acid amide hydrolase 1
Synonyms:Anandamide amidohydrolase | Anandamide amidohydrolase 1 | FAAH | FAAH1 | Fatty Acid Amide Hydrolase (FAAH) | Fatty-acid amide hydrolase (FAAH) | Oleamide hydrolase 1
Type:Protein
Mol. Mass.:63071.19
Organism:Homo sapiens (Human)
Description:O00519
Residue:579
Sequence:
MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQ
RFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLAD
CETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAV
PFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE
DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTL
VPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALD
LNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMK
KSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50021331
n/a
NameBDBM50021331
Synonyms:CHEMBL3287930
TypeSmall organic molecule
Emp. Form.C22H18ClFN4OS
Mol. Mass.440.921
SMILESCC(C)(O)c1cnc(cn1)-c1nn(cc1Sc1ccc(Cl)cc1)-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: