Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeprilysin
LigandBDBM50024101
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1367181
Ki 0.700000±n/a nM
Citation Poras HBonnard EDangé EFournié-Zaluski MCRoques BP New orally active dual enkephalinase inhibitors (DENKIs) for central and peripheral pain treatment. J Med Chem 57:5748-63 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neprilysin
Name:Neprilysin
Synonyms:Atriopeptidase | CALLA | CD_antigen=CD10 | Common acute lymphocytic leukemia antigen | Enkephalinase | NEP | Neutral Endopeptidase (NEP) | Neutral endopeptidase | Neutral endopeptidase 24.11
Type:Enzyme
Mol. Mass.:85505.38
Organism:Homo sapiens (Human)
Description:P08473
Residue:750
Sequence:
MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKD
VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGA
SWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYLTKLKPILT
KYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYR
AYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50024101
n/a
NameBDBM50024101
Synonyms:(S)-2-((S)-2-Mercaptomethyl-3-phenyl-propionylamino)-propionic acid | (S,S) 2-(2-Mercaptomethyl-3-phenyl-propionylamino)-propionic acid | CHEMBL51715
TypeSmall organic molecule
Emp. Form.C13H17NO3S
Mol. Mass.267.344
SMILESC[C@H](NC(=O)[C@@H](CS)Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: