Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAminopeptidase N
LigandBDBM50025047
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1442055
Ki 155±n/a nM
Citation Vassiliou SWeglarz-Tomczak EBerlicki LPawelczak MNocek BMulligan RJoachimiak AMucha A Structure-guided, single-point modifications in the phosphinic dipeptide structure yield highly potent and selective inhibitors of neutral aminopeptidases. J Med Chem 57:8140-51 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aminopeptidase N
Name:Aminopeptidase N
Synonyms:ANPEP | AP-M | AP-N | Alanyl aminopeptidase | Aminopeptidase M | Aminopeptidase N (APN) | CD_antigen=CD13 | Microsomal aminopeptidase | gp130 | pAPN
Type:Protein
Mol. Mass.:108810.25
Organism:Sus scrofa (Pig)
Description:P15145
Residue:963
Sequence:
MAKGFYISKALGILGILLGVAAVATIIALSVVYAQEKNKNAEHVPQAPTSPTITTTAAIT
LDQSKPWNRYRLPTTLLPDSYNVTLRPYLTPNADGLYIFKGKSIVRLLCQEPTDVIIIHS
KKLNYTTQGHMVVLRGVGDSQVPEIDRTELVELTEYLVVHLKGSLQPGHMYEMESEFQGE
LADDLAGFYRSEYMEGNVKKVLATTQMQSTDARKSFPCFDEPAMKATFNITLIHPNNLTA
LSNMPPKGSSTPLAEDPNWSVTEFETTPVMSTYLLAYIVSEFQSVNETAQNGVLIRIWAR
PNAIAEGHGMYALNVTGPILNFFANHYNTSYPLPKSDQIALPDFNAGAMENWGLVTYREN
ALLFDPQSSSISNKERVVTVIAHELAHQWFGNLVTLAWWNDLWLNEGFASYVEYLGADHA
EPTWNLKDLIVPGDVYRVMAVDALASSHPLTTPAEEVNTPAQISEMFDSISYSKGASVIR
MLSNFLTEDLFKEGLASYLHAFAYQNTTYLDLWEHLQKAVDAQTSIRLPDTVRAIMDRWT
LQMGFPVITVDTKTGNISQKHFLLDSESNVTRSSAFDYLWIVPISSIKNGVMQDHYWLRD
VSQAQNDLFKTASDDWVLLNVNVTGYFQVNYDEDNWRMIQHQLQTNLSVIPVINRAQVIY
DSFNLATAHMVPVTLALDNTLFLNGEKEYMPWQAALSSLSYFSLMFDRSEVYGPMKKYLR
KQVEPLFQHFETLTKNWTERPENLMDQYSEINAISTACSNGLPQCENLAKTLFDQWMSDP
ENNPIHPNLRSTIYCNAIAQGGQDQWDFAWGQLQQAQLVNEADKLRSALACSNEVWLLNR
YLGYTLNPDLIRKQDATSTINSIASNVIGQPLAWDFVQSNWKKLFQDYGGGSFSFSNLIQ
GVTRRFSSEFELQQLEQFKKNNMDVGFGSGTRALEQALEKTKANIKWVKENKEVVLNWFI
EHS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50025047
n/a
NameBDBM50025047
Synonyms:CHEMBL3355100
TypeSmall organic molecule
Emp. Form.C21H28NO4P
Mol. Mass.389.4251
SMILESCc1cc(C)cc(CCC(N)P(O)(=O)CC(Cc2ccccc2)C(O)=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: