| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cytosol aminopeptidase [33-68,L62W] |
|---|
| Ligand | BDBM50025070 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1442056 (CHEMBL3373424) |
|---|
| Ki | 74±n/a nM |
|---|
| Citation |  Vassiliou, S; Weglarz-Tomczak, E; Berlicki, L; Pawelczak, M; Nocek, B; Mulligan, R; Joachimiak, A; Mucha, A Structure-guided, single-point modifications in the phosphinic dipeptide structure yield highly potent and selective inhibitors of neutral aminopeptidases. J Med Chem57:8140-51 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cytosol aminopeptidase [33-68,L62W] |
|---|
| Name: | Cytosol aminopeptidase [33-68,L62W] |
|---|
| Synonyms: | AMPL_PIG | Cytosol aminopeptidase | LAP3 | Leucine aminopeptidase (LAP) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 4015.44 |
|---|
| Organism: | Sus scrofa (Pig) |
|---|
| Description: | P28839[33-68,L62W] |
|---|
| Residue: | 36 |
|---|
| Sequence: | TKGLVLGIYSKEKEDDAPQFTSAGENFDKWVSGKLR
|
|
|
|---|
| BDBM50025070 |
|---|
| n/a |
|---|
| Name | BDBM50025070 |
|---|
| Synonyms: | CHEMBL3355110 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H26N3O4P |
|---|
| Mol. Mass. | 391.4012 |
|---|
| SMILES | NCc1ccc(CC(CP(O)(=O)C(N)CCc2cccnc2)C(O)=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
