| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Retinol-binding protein 4 |
|---|
| Ligand | BDBM50019040 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1441245 (CHEMBL3380010) |
|---|
| IC50 | 0.155000±n/a nM |
|---|
| Citation |  Cioffi, CL; Dobri, N; Freeman, EE; Conlon, MP; Chen, P; Stafford, DG; Schwarz, DM; Golden, KC; Zhu, L; Kitchen, DB; Barnes, KD; Racz, B; Qin, Q; Michelotti, E; Cywin, CL; Martin, WH; Pearson, PG; Johnson, G; Petrukhin, K Design, synthesis, and evaluation of nonretinoid retinol binding protein 4 antagonists for the potential treatment of atrophic age-related macular degeneration and Stargardt disease. J Med Chem57:7731-57 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Retinol-binding protein 4 |
|---|
| Name: | Retinol-binding protein 4 |
|---|
| Synonyms: | PRBP | Plasma retinol-binding protein | RBP | RBP4 | RET4_HUMAN | Retinol-binding protein 4 | Retinol-binding protein 4 (RBP4) | spa binding assay for rbp4 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23008.75 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P02753 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
|
|
|
|---|
| BDBM50019040 |
|---|
| n/a |
|---|
| Name | BDBM50019040 |
|---|
| Synonyms: | CHEMBL1230001 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19F3N2O3 |
|---|
| Mol. Mass. | 392.3717 |
|---|
| SMILES | OC(=O)c1ccccc1NC(=O)N1CCC(CC1)c1ccccc1C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
