Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1-deoxy-D-xylulose-5-phosphate synthase
LigandBDBM50026312
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1441266
Ki 6700±n/a nM
Citation Masini THirsch AK Development of inhibitors of the 2C-methyl-D-erythritol 4-phosphate (MEP) pathway enzymes as potential anti-infective agents. J Med Chem 57:9740-63 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
1-deoxy-D-xylulose-5-phosphate synthase
Name:1-deoxy-D-xylulose-5-phosphate synthase
Synonyms:1-deoxy-D-xylulose-5-phosphate synthase | 1-deoxyxylulose-5-phosphate synthase | DXP synthase | DXPS | dxs
Type:PROTEIN
Mol. Mass.:67649.22
Organism:Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Description:ChEMBL_109718
Residue:620
Sequence:
MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELT
VALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSV
GHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLND
NEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPIKELLKRTEEHIKGMVVPG
TLFEELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIMTKKGRGYEPAEKDPITFHA
VPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFP
DRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDR
AGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGN
AVGVELTPLEKLPIGKGIVKRRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDE
ALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVPVLNIGLLDFFIPQGTQEEM
RAELGLDATGMEAKIKAWLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50026312
n/a
NameBDBM50026312
Synonyms:CHEMBL3306297
TypeSmall organic molecule
Emp. Form.C4H9O4P
Mol. Mass.152.0856
SMILESCCOP(O)(=O)C(C)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: