Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1-deoxy-D-xylulose-5-phosphate synthase
LigandBDBM50026326
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1441267
Ki 4000±n/a nM
Citation Masini THirsch AK Development of inhibitors of the 2C-methyl-D-erythritol 4-phosphate (MEP) pathway enzymes as potential anti-infective agents. J Med Chem 57:9740-63 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
1-deoxy-D-xylulose-5-phosphate synthase
Name:1-deoxy-D-xylulose-5-phosphate synthase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:67882.02
Organism:Mycobacterium tuberculosis
Description:ChEMBL_1441273
Residue:638
Sequence:
MLQQIRGPADLQHLSQAQLRELAAEIREFLIHKVAATGGHLGPNLGVVELTLALHRVFDS
PHDPIIFDTGHQAYVHKMLTGRSQDFATLRKKGGLSGYPSRAESEHDWVESSHASAALSY
ADGLAKAFELTGHRNRHVVAVVGDGALTGGMCWEALNNIAASRRPVIIVVNDNGRSYAPT
IGGVADHLATLRLQPAYEQALETGRDLVRAVPLVGGLWFRFLHSVKAGIKDSLSPQLLFT
DLGLKYVGPVDGHDERAVEVALRSARRFGAPVIVHVVTRKGMGYPPAEADQAEQMHSTVP
IDPATGQATKVAGPGWTATFSDALIGYAQKRRDIVAITAAMPGPTGLTAFGQRFPDRLFD
VGIAEQHAMTSAAGLAMGGLHPVVAIYSTFLNRAFDQIMMDVALHKLPVTMVLDRAGITG
SDGASHNGMWDLSMLGIVPGIRVAAPRDATRLREELGEALDVDDGPTALRFPKGDVGEDI
SALERRGGVDVLAAPADGLNHDVLLVAIGAFAPMALAVAKRLHNQGIGVTVIDPRWVLPV
SDGVRELAVQHKLLVTLEDNGVNGGAGSAVSAALRRAEIDVPCRDVGLPQEFYEHASRSE
VLADLGLTDQDVARRITGWVAALGTGVCASDAIPEHLD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50026326
n/a
NameBDBM50026326
Synonyms:CHEMBL3305928
TypeSmall organic molecule
Emp. Form.C6H13O4P
Mol. Mass.180.1388
SMILESCCCCOP(O)(=O)C(C)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: