Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1-deoxy-D-xylulose-5-phosphate synthase
LigandBDBM50026351
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1441269
IC50 3100±n/a nM
Citation Masini THirsch AK Development of inhibitors of the 2C-methyl-D-erythritol 4-phosphate (MEP) pathway enzymes as potential anti-infective agents. J Med Chem 57:9740-63 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
1-deoxy-D-xylulose-5-phosphate synthase
Name:1-deoxy-D-xylulose-5-phosphate synthase
Synonyms:1-deoxy-D-xylulose-5-phosphate synthase | 1-deoxyxylulose-5-phosphate synthase | DXP synthase | DXPS | dxs
Type:PROTEIN
Mol. Mass.:68590.64
Organism:Haemophilus influenzae (strain 86-028NP)
Description:ChEMBL_109723
Residue:625
Sequence:
MTNNMNNYPLLSLINSPEDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASGLGTVELT
VALHYVYKTPFDQLIWDVGHQAYPHKILTGRREQMSTIRQKDGIHPFPWREESEFDVLSV
GHSSTSISAGLGIAVAAERENAGRKTVCVIGDGAITAGMAFEALNHAGALHTDMLVILND
NEMSISENVGALNNHLARIFSGSLYSTLRDGSKKILDKVPPIKNFMKKTEEHMKGVMFSP
ESTLFEELGFNYIGPVDGHNIDELVAMLTNMRNLKGPQFLHIKTKKGKGYAPAEKDPIGF
HGVPKFDPISGELPKNNSKPTYSKIFGDWLCEMAEKDAKIIGITPAMREGSGMVEFSQRF
PKQYFDVAIAEQHTVTFATGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAID
RAGIVGADGATHQGAFDISFMRCIPNMIIMTPSDENECRQMLYTGYQCGKPAAVRYPRGN
AVGVKLTPLEMLPIGKSRLIRKGQKIAILNFGTLLPSALELSEKLNATVVDMRFVKPIDI
EMINVLAQTHDYLVTLEENAIQGGAGSAVAEVLNSSGKSTALLQLGLPDYFIPQATRQEA
LADLGLDTKGIEEKILNFIAKQGNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50026351
n/a
NameBDBM50026351
Synonyms:CHEMBL3359032
TypeSmall organic molecule
Emp. Form.C12H16ClNO3
Mol. Mass.257.713
SMILESCC(C)(CO)C(=O)N(O)Cc1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: