Reaction Details |
| Report a problem with these data |
Target | Folate receptor alpha |
---|
Ligand | BDBM18050 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1431345 (CHEMBL3387471) |
---|
IC50 | 114±n/a nM |
---|
Citation | Golani, LK; George, C; Zhao, S; Raghavan, S; Orr, S; Wallace, A; Wilson, MR; Hou, Z; Matherly, LH; Gangjee, A Structure-activity profiles of novel 6-substituted pyrrolo[2,3-d]pyrimidine thienoyl antifolates with modified amino acids for cellular uptake by folate receptorsa andß and the proton-coupled folate transporter. J Med Chem57:8152-66 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Folate receptor alpha |
---|
Name: | Folate receptor alpha |
Synonyms: | Adult folate-binding protein | FBP | FOLR | FOLR1 | FOLR1_HUMAN | FR-alpha | Folate receptor 1 | Folate receptor, adult | KB cells FBP | Ovarian tumor-associated antigen MOv18 |
Type: | PROTEIN |
Mol. Mass.: | 29827.41 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1469596 |
Residue: | 257 |
Sequence: | MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPW
RKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQV
DQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHF
YFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWA
AWPFLLSLALMLLWLLS
|
|
|
BDBM18050 |
---|
n/a |
---|
Name | BDBM18050 |
Synonyms: | 2-[(4-{[(2,4-diaminopteridin-6-yl)methyl](methyl)amino}phenyl)formamido]pentanedioic acid | CHEMBL34259 | MTX | Methotrexate | cid_126941 |
Type | Small organic molecule |
Emp. Form. | C20H22N8O5 |
Mol. Mass. | 454.4393 |
SMILES | CN(Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r| |
Structure |
|