Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 11
LigandBDBM50027664
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1433108
IC50 75300±n/a nM
Citation Tang GWong JCZhang WWang ZZhang NPeng ZZhang ZRong YLi SZhang MYu LFeng TZhang XWu XWu JZChen L Identification of a novel aminotetralin class of HDAC6 and HDAC8 selective inhibitors. J Med Chem 57:8026-34 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 11
Name:Histone deacetylase 11
Synonyms:HD11 | Human HDAC11
Type:Chromatin regulator; hydrolase; repressor
Mol. Mass.:39187.66
Organism:Homo sapiens (Human)
Description:Recombinant HDAC11 was expressed in Sf9 cells.
Residue:347
Sequence:
MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSML
VEAREASEEDLLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGG
TIMAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDL
DAHQGNGHERDFMDDKRVYIMDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLDKVER
NIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVKRDELVFRMVRGRRVPILMVT
SGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027664
n/a
NameBDBM50027664
Synonyms:CHEMBL3338404
TypeSmall organic molecule
Emp. Form.C21H19N3O5
Mol. Mass.393.3927
SMILESONC(=O)c1ccc2CCN(Cc3ccc(o3)-c3cccc(c3)[N+]([O-])=O)Cc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: