| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Orexin receptor type 2 |
|---|
| Ligand | BDBM106968 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1433181 (CHEMBL3387581) |
|---|
| IC50 | 21±n/a nM |
|---|
| Citation |  Roecker, AJ; Reger, TS; Mattern, MC; Mercer, SP; Bergman, JM; Schreier, JD; Cube, RV; Cox, CD; Li, D; Lemaire, W; Bruno, JG; Harrell, CM; Garson, SL; Gotter, AL; Fox, SV; Stevens, J; Tannenbaum, PL; Prueksaritanont, T; Cabalu, TD; Cui, D; Stellabott, J; Hartman, GD; Young, SD; Winrow, CJ; Renger, JJ; Coleman, PJ Discovery of MK-3697: a selective orexin 2 receptor antagonist (2-SORA) for the treatment of insomnia. Bioorg Med Chem Lett24:4884-90 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Orexin receptor type 2 |
|---|
| Name: | Orexin receptor type 2 |
|---|
| Synonyms: | HCRTR2 | Hypocretin receptor type 2 | OX2R_HUMAN | Orexin receptor type 2 (OR 2) | Orexin receptor type 2 (OR-2) | Orexin receptor type 2 (OX2) | Orexin receptor type 2 (OX2R) | Orexin receptor type 2 (OxR2) | Ox-2-R | Ox2-R |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 50710.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O43614 |
|---|
| Residue: | 444 |
|---|
| Sequence: | MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG
YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW
FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVS
CIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMV
LAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR
KTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAAN
PIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKL
SEQVVLTSISTLPAANGAGPLQNW
|
|
|
|---|
| BDBM106968 |
|---|
| n/a |
|---|
| Name | BDBM106968 |
|---|
| Synonyms: | US8592457, 1-5 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H24N4O3 |
|---|
| Mol. Mass. | 440.4938 |
|---|
| SMILES | COc1ccc(CNC(=O)c2cc(ncc2-c2ccccc2)-c2cncc(C)c2)nc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
