Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 2
LigandBDBM50028142
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1434740
IC50 3.2±n/a nM
Citation Gosmini RNguyen VLToum JSimon CBrusq JMKrysa GMirguet ORiou-Eymard AMBoursier EVTrottet LBamborough PClark HChung CWCutler LDemont EHKaur RLewis AJSchilling MBSoden PETaylor SWalker ALWalker MDPrinjha RKNicodème E The discovery of I-BET726 (GSK1324726A), a potent tetrahydroquinoline ApoA1 up-regulator and selective BET bromodomain inhibitor. J Med Chem 57:8111-31 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 2
Name:Bromodomain-containing protein 2
Synonyms:Bromodomain-containing protein 2 | Bromodomain-containing protein 2 (BRD2)
Type:Protein
Mol. Mass.:88085.95
Organism:Homo sapiens (Human)
Description:P25440
Residue:801
Sequence:
MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPAN
PPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQP
MDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASM
PQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNI
PHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVKRKADTTTPTPTAILAPGSPA
SPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKEL
LSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL
MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKSSSES
SSEESSSESSSEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQG
PISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAAL
GPSGFGPSGGSGTKLPKKATKTAPPALPTGYDSEEEEESRPMSYDEKRQLSLDINKLPGE
KLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELERYVLSCLRKKPRKPYTIKKP
VGKTKEELALEKKRELEKRLQDVSGQLNSTKKPPKKANEKTESSSAQQVAVSRLSASSSS
SDSSSSSSSSSSSDTSDSDSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50028142
n/a
NameBDBM50028142
Synonyms:CHEMBL2177300
TypeSmall organic molecule
Emp. Form.C25H23ClN2O3
Mol. Mass.434.915
SMILESC[C@H]1C[C@@H](Nc2ccc(Cl)cc2)c2cc(ccc2N1C(C)=O)-c1ccc(cc1)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: