Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-butyrobetaine dioxygenase
LigandBDBM50028968
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1434108
IC50 2200±n/a nM
Citation Rydzik AMBrem JStruwe WBKochan GTBenesch JLSchofield CJ Ejection of structural zinc leads to inhibition of┐-butyrobetaine hydroxylase. Bioorg Med Chem Lett 24:4954-7 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gamma-butyrobetaine dioxygenase
Name:Gamma-butyrobetaine dioxygenase
Synonyms:BBH | BBOX | BBOX1 | Gamma-BBH | Gamma-butyrobetaine hydroxylase | Gamma-butyrobetaine,2-oxoglutarate dioxygenase
Type:PROTEIN
Mol. Mass.:44715.93
Organism:Homo sapiens (Human)
Description:ChEMBL_1434107
Residue:387
Sequence:
MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDV
NIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSEL
QLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHT
WQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQK
LKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIF
DVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISR
HLEGAYADWDVVMSRLRILRQRVENGN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50028968
n/a
NameBDBM50028968
Synonyms:CHEMBL3335712
TypeSmall organic molecule
Emp. Form.C6H5ClSe
Mol. Mass.191.52
SMILESCl[Se]c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: