Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM50029963
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1438383
Ki 33±n/a nM
Citation Lucchesi VHurst DPShore DMBertini SEhrmann BMAllarÓ MLawrence LLigresti AMinutolo FSaccomanni GSharir HMacchia MDi Marzo VAbood MEReggio PHManera C CB2-selective cannabinoid receptor ligands: synthesis, pharmacological evaluation, and molecular modeling investigation of 1,8-Naphthyridin-2(1H)-one-3-carboxamides. J Med Chem 57:8777-91 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:CANN6 | CANNABINOID CB1 | CB-R | CB1 | CNR | CNR1 | Cannabinoid CB1 receptor | Cannabinoid receptor | Cannabinoid receptor 1 (CB1) | Cannabinoid receptor 1 (brain)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52868.96
Organism:Homo sapiens (Human)
Description:P21554
Residue:472
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029963
n/a
NameBDBM50029963
Synonyms:CHEMBL3353452
TypeSmall organic molecule
Emp. Form.C26H32N4O3S
Mol. Mass.480.622
SMILESCC1CCC(CC1)NC(=O)c1cc2cc(cnc2n(CCN2CCOCC2)c1=O)-c1cccs1 |(26.44,-2.21,;25.11,-2.98,;25.11,-4.52,;23.79,-5.29,;22.45,-4.52,;22.44,-2.99,;23.77,-2.21,;21.12,-5.3,;19.78,-4.54,;19.77,-3,;18.45,-5.31,;17.12,-4.55,;15.79,-5.33,;14.46,-4.56,;13.13,-5.33,;13.13,-6.88,;14.46,-7.65,;15.79,-6.87,;17.13,-7.64,;17.13,-9.17,;18.46,-9.94,;18.47,-11.48,;17.14,-12.25,;17.14,-13.78,;18.47,-14.56,;19.81,-13.79,;19.81,-12.24,;18.46,-6.86,;19.8,-7.63,;11.79,-4.56,;10.38,-5.19,;9.35,-4.05,;10.12,-2.71,;11.63,-3.03,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: