Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase B |
---|
Ligand | BDBM50339126 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1436363 (CHEMBL3389005) |
---|
Kd | 7.4±n/a nM |
---|
Citation | Fu, J; Tjandra, M; Becker, C; Bednarczyk, D; Capparelli, M; Elling, R; Hanna, I; Fujimoto, R; Furegati, M; Karur, S; Kasprzyk, T; Knapp, M; Leung, K; Li, X; Lu, P; Mergo, W; Miault, C; Ng, S; Parker, D; Peng, Y; Roggo, S; Rivkin, A; Simmons, RL; Wang, M; Wiedmann, B; Weiss, AH; Xiao, L; Xie, L; Xu, W; Yifru, A; Yang, S; Zhou, B; Sweeney, ZK Potent nonimmunosuppressive cyclophilin inhibitors with improved pharmaceutical properties and decreased transporter inhibition. J Med Chem57:8503-16 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase B |
---|
Name: | Peptidyl-prolyl cis-trans isomerase B |
Synonyms: | CYP-S1 | CYPB | Cyclophilin B | Cyclophilin B (CypB) | PPIB | PPIB_HUMAN | PPIase | Peptidyl-prolyl cis-trans isomerase B | Rotamase | S-cyclophilin | SCYLP |
Type: | Protein |
Mol. Mass.: | 23751.82 |
Organism: | Homo sapiens (Human) |
Description: | P23284 |
Residue: | 216 |
Sequence: | MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV
IFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG
ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR
KVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
|
|
|
BDBM50339126 |
---|
n/a |
---|
Name | BDBM50339126 |
Synonyms: | (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-24-sec-butyl-30-ethyl-33-((1R,2R)-1-hydroxy-2-methylhex-4-enyl)-6,9,18-triisobutyl-3,21-diisopropyl-1,4,7,10,12,15,19,25,28-nonamethyl-1,4,7,10,13,16,19,22,25,28,31-undecaazacyclotritriacontan-2,5,8,11,14,17,20,23,26,29,32-undecaone | CHEMBL1688529 |
Type | Small organic molecule |
Emp. Form. | C62H111N11O12 |
Mol. Mass. | 1202.6112 |
SMILES | CC[C@H](C)[C@@H]1N(C)C(=O)CN(C)C(=O)[C@H](CC)NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](NC1=O)C(C)C |r| |
Structure |
|