| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase F, mitochondrial |
|---|
| Ligand | BDBM50030493 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1436364 (CHEMBL3389567) |
|---|
| Kd | 0.900000±n/a nM |
|---|
| Citation |  Fu, J; Tjandra, M; Becker, C; Bednarczyk, D; Capparelli, M; Elling, R; Hanna, I; Fujimoto, R; Furegati, M; Karur, S; Kasprzyk, T; Knapp, M; Leung, K; Li, X; Lu, P; Mergo, W; Miault, C; Ng, S; Parker, D; Peng, Y; Roggo, S; Rivkin, A; Simmons, RL; Wang, M; Wiedmann, B; Weiss, AH; Xiao, L; Xie, L; Xu, W; Yifru, A; Yang, S; Zhou, B; Sweeney, ZK Potent nonimmunosuppressive cyclophilin inhibitors with improved pharmaceutical properties and decreased transporter inhibition. J Med Chem57:8503-16 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase F, mitochondrial |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase F, mitochondrial |
|---|
| Synonyms: | CYP3 | CyP-D | CyP-M | Cyclophilin D | Cyclophilin F | CypD | Mitochondrial cyclophilin | PPIF | PPIF_HUMAN | PPIase F | Rotamase F |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22052.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_109465 |
|---|
| Residue: | 207 |
|---|
| Sequence: | MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLG
RVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSI
YGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDV
VKKIESFGSKSGRTSKKIVITDCGQLS
|
|
|
|---|
| BDBM50030493 |
|---|
| n/a |
|---|
| Name | BDBM50030493 |
|---|
| Synonyms: | CHEMBL3344501 | US9566312, Compound 2.17.4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C69H125N13O13 |
|---|
| Mol. Mass. | 1344.8101 |
|---|
| SMILES | [H][C@@]1([C@@H](C)CN2CCN(CCOC)CC2)N(C)C(=O)[C@@H](C)N(C)C(=O)[C@H](CC)NC(=O)[C@]([H])([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](NC1=O)C(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
