Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 12
LigandBDBM50349858
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1436382
Ki 1.5±n/a nM
Citation Bozdag MFerraroni MCarta FVullo DLucarini LOrlandini ERossello ANuti EScozzafava AMasini ESupuran CT Structural insights on carbonic anhydrase inhibitory action, isoform selectivity, and potency of sulfonamides and coumarins incorporating arylsulfonylureido groups. J Med Chem 57:9152-67 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 12
Name:Carbonic anhydrase
Synonyms:CA-XII | Carbonate dehydratase XII | Carbonic anhydrase 12 (CA XII) | Carbonic anhydrase XII (CA XII) | Carbonic anhydrase XII (CAXII) | Tumor antigen HOM-RCC-3.1.3
Type:Enzyme
Mol. Mass.:39456.00
Organism:Homo sapiens (Human)
Description:Catalytic domain of human cloned isozyme was used in the assay
Residue:354
Sequence:
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50349858
n/a
NameBDBM50349858
Synonyms:CHEMBL78755
TypeSmall organic molecule
Emp. Form.C14H15N3O5S2
Mol. Mass.369.416
SMILESCc1ccc(cc1)S(=O)(=O)NC(=O)Nc1ccc(cc1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: