Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 5 (MC5R)
LigandBDBM50031471
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1438568
EC50 0.150000±n/a nM
Citation Testa CScrima MGrimaldi MD'Ursi AMDirain MLLubin-Germain NSingh AHaskell-Luevano CChorev MRovero PPapini AM 1,4-disubstituted-[1,2,3]triazolyl-containing analogues of MT-II: design, synthesis, conformational analysis, and biological activity. J Med Chem 57:9424-34 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 5 (MC5R)
Name:Melanocortin receptor 5
Synonyms:Melanocortin receptor 5
Type:Enzyme
Mol. Mass.:36966.58
Organism:Mus musculus (Mouse)
Description:P41149
Residue:325
Sequence:
MNSSSTLTVLNLTLNASEDGILGSNVKNKSLACEEMGIAVEVFLTLGLVSLLENILVIGA
IVKNKNLHSPMYFFVGSLAVADMLVSMSNAWETVTIYLLNNKHLVIADTFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYITIFYALRYHHIMTARRSGVIIACIWTFCISCGIVFIIY
YESKYVIICLISMFFTMLFFMVSLYIHMFLLARNHVKRIAASPRYNSVRQRTSMKGAITL
TMLLGIFIVCWSPFFLHLILMISCPQNVYCSCFMSYFNMYLILIMCNSVIDPLIYALRSQ
EMRRTFKEIVCCHGFRRPCRLLGGY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031471
n/a
NameBDBM50031471
Synonyms:CHEMBL3358550
TypeSmall organic molecule
Emp. Form.C51H69N17O8
Mol. Mass.1048.2027
SMILESCCCC[C@H](NC(C)=O)C(=O)N[C@H]1Cn2cc(CCCC[C@H](NC(=O)[C@H](Cc3c[nH]c4ccccc34)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](Cc3ccccc3)NC(=O)[C@H](Cc3cnc[nH]3)NC1=O)C(N)=O)nn2 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: