Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 1
LigandBDBM50031494
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1438565
EC50 0.240000±n/a nM
Citation Testa CScrima MGrimaldi MD'Ursi AMDirain MLLubin-Germain NSingh AHaskell-Luevano CChorev MRovero PPapini AM 1,4-disubstituted-[1,2,3]triazolyl-containing analogues of MT-II: design, synthesis, conformational analysis, and biological activity. J Med Chem 57:9424-34 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 1
Name:Melanocortin receptor 1
Synonyms:MC1-R | MSH-R | Melanocyte-stimulating hormone receptor
Type:PROTEIN
Mol. Mass.:35238.60
Organism:Mus musculus
Description:ChEMBL_1498846
Residue:315
Sequence:
MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIA
ITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDV
LICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITY
YKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAAT
LTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRS
QELRMTLKEVLLCSW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031494
n/a
NameBDBM50031494
Synonyms:CHEMBL3358537
TypeSmall organic molecule
Emp. Form.C51H69N17O8
Mol. Mass.1048.2027
SMILESCCCC[C@H](NC(C)=O)C(=O)N[C@@H](CCCCN=[N+]=[N-])C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC#C)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: