Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 1
LigandBDBM50031588
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1441654
Kd 560±n/a nM
Citation Dudutiene VMatuliene JSmirnov ATimm DDZubriene ABaranauskiene LMorkunaite VSmirnoviene JMichailoviene VJuozapaitiene VMickeviciute AKazokaite JBak?yte SKasiliauskaite AJachno JRevuckiene JKi?onaite MPilipuityte VIvanauskaite EMilinaviciute GSmirnovas VPetrikaite VKairys VPetrauskas VNorvai?as PLinge DGibie?a PCapkauskaite EZak?auskas AKazlauskas EManakova EGra?ulis SLadbury JEMatulis D Discovery and characterization of novel selective inhibitors of carbonic anhydrase IX. J Med Chem 57:9435-46 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 1
Name:Carbonic anhydrase
Synonyms:CA-I | CAB | Carbonate dehydratase I | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA
Type:Enzyme
Mol. Mass.:28873.37
Organism:Homo sapiens (Human)
Description:P00915
Residue:261
Sequence:
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031588
n/a
NameBDBM50031588
Synonyms:CHEMBL3359181
TypeSmall organic molecule
Emp. Form.C16H23F3N2O5S2
Mol. Mass.444.489
SMILESNS(=O)(=O)c1c(F)c(F)c(c(NC2CCCCCCC2)c1F)S(=O)(=O)CCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: